PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_023855
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 565aa    MW: 61223.9 Da    PI: 4.8607
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_023855genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.89.2e-33259316260
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  +DgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers  d++++ei+Y+g Hnh+k
  DCAR_023855 259 EDGYNWRKYGQKQVKGSEYPRSYYKCTQQNCQVKKKVERSL-DGQITEIIYKGAHNHPK 316
                  7****************************************.***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081124.053253317IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-28254317IPR003657WRKY domain
SuperFamilySSF1182903.53E-26254317IPR003657WRKY domain
SMARTSM007741.7E-36258316IPR003657WRKY domain
PfamPF031063.1E-25259315IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MHGDKFDECW KFDEFSGMCE GMSDEIVVVK NESGVKVEEV NEEDEAKPIM GSIAERRAGF  60
DAPKIDVVRF RGVGSPVSSP SGRSPYLTIP AGISPTALLD SPVMLLNSQA AHSSPTTGTY  120
QSPSFNHESM MQSAAGAADT DGDCDVSSSL SYKLAGLPCV SELADKPPID FKCPAKYLRE  180
TATDNCATGS TAYAVNLSED TIFNVRSTAL KRSRHTNTES DQMSLFSETS NGVDTEVSRL  240
LEGQQKEAYP PLETLRTSED GYNWRKYGQK QVKGSEYPRS YYKCTQQNCQ VKKKVERSLD  300
GQITEIIYKG AHNHPKPQPS RRAILGCQFS PKISDILSNT RGKSMGAFES SGTPELSSTF  360
ASHDGDDEDG ATQGSVSLEE DAEDGESESK RRTTNAPKPE PPVPDIALHF ERNPAARNNF  420
MRPYVVGNLG TDMKFGAPSL YQVKLPPLPN SMSFGSYLMN PDHTDPPAAC SVSSVLPGYS  480
FSLPMTIPGS GNINQSGVDL SCNGKSMDSV HPFLDGQLHQ NDLKFVEPKV EKDDNLYGSS  540
LPISDQANSA SSSMFHQING KFPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A8e-162593171877Probable WRKY transcription factor 4
1wj2_A8e-162593171877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015875770.14e-93PREDICTED: WRKY transcription factor SUSIBA2-like
TrEMBLA0A061EYY81e-87A0A061EYY8_THECC; WRKY DNA-binding protein 2, putative isoform 1
TrEMBLA0A061F5S48e-88A0A061F5S4_THECC; WRKY DNA-binding protein 2, putative isoform 2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57672237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.25e-35WRKY family protein